PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn218951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 784aa    MW: 86083.4 Da    PI: 4.6574
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn218951genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like26.41.6e-08204244142
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLt 42 
                 kpr++W+ eLH +Fv av+qL G+e+   +  l+ ++   Lt
  Achn218951 204 KPRVVWSIELHGKFVAAVNQL-GIERISAQLELNQLQQSKLT 244
                 79*******************.88876666666666666665 PP

2Response_reg79.31.3e-26231311109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll  +l+k +y +v++ ++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++ +++ + +  Ga 
    Achn218951  23 VLAVDDDPTCLKLLDGLLRKCQY-QVTTSSQAKTALKMLRENKnrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDTKLVMKGITHGAC 117
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+ +eel++
    Achn218951 118 DYLVKPVRIEELRN 131
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.85E-3520144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.3E-4320144No hitNo description
SMARTSM004487.0E-3221133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.70222137IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.5E-2423132IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.93E-2824137No hitNo description
Gene3DG3DSA:1.10.10.601.4E-8201246IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MTVEEIRGNC GRENSNFPLG MRVLAVDDDP TCLKLLDGLL RKCQYQVTTS SQAKTALKML  60
RENKNRFDLV ISDVHMPDMD GFKLLELVGL EMDLPVIMLS ANSDTKLVMK GITHGACDYL  120
VKPVRIEELR NIWQHVLRRK KFDSKSPTVD EACQGNGKSL KESEPTGNED KNGKVNRKRK  180
DEEEEEEEDE ENGEENEDLA TQKKPRVVWS IELHGKFVAA VNQLGIERIS AQLELNQLQQ  240
SKLTSDMFDS GCDPTIFTST SSLVDNIVPV GSLINSLPSA SSNPLFLQGN PQQTLSGGVF  300
GNQNSFKVNS LNSEPLNTGI SGSNFLSNGR CNENWRSTIQ VSKFSSNNPS SLSGTFNHDR  360
LPSNGMRTNN SSSGLHIQIN PLDFSSTDTI SAPLEDSREI RCQAGFVGDV QSMSQATDEK  420
CGDYKMDYTQ NSNHIFNTLN SMVPPNGAVG PVSWMLDQHN GVCNGKIDSS FISQSNGSPS  480
PLVQLSEIEK SATELKTRSN EDYHLGQMKL QGGLVHNSYD SLDDLMNEMI SQNSFKVNSL  540
NSEPLNTGIS GSNFLSNGRC NENWRSTIQV SKFSSNNPSS LSGTFNHDRL PSNGMRTNNS  600
SSGLHIQINP LDFSSTDTIS APLEDSREIR CQAGFVGDVQ SMSQATDEKC GDYKMDYTQN  660
SNHIFNTLNS MVPPNGAVGP VSWMLDQHNG VCNGKIDSSF ISQSNGSPSP LVQLSEIEKS  720
ATELKTRSNE DYHLGQMKLQ GGLVHNSYDS LDDLMNEMIS QDQNGPMLVD GEFGFDAYSF  780
GSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3r0j_A3e-132214725149POSSIBLE TWO COMPONENT SYSTEM RESPONSE TRANSC
3r0j_B3e-132214725149POSSIBLE TWO COMPONENT SYSTEM RESPONSE TRANSC
3t6k_A9e-14201491134Response regulator receiver
3t6k_B9e-14201491134Response regulator receiver
4h60_A5e-14221374120Chemotaxis protein CheY
4hnr_A7e-14221374120Chemotaxis protein CheY
5ed4_A3e-132214725149Response regulator
5ed4_B3e-132214725149Response regulator
5ed4_E3e-132214725149Response regulator
5ed4_F3e-132214725149Response regulator
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061688.11e-113PREDICTED: two-component response regulator ORR24-like
TrEMBLA0A068UNX61e-115A0A068UNX6_COFCA; Uncharacterized protein
STRINGSolyc12g010330.1.11e-112(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.14e-82response regulator 12